Glyma03g09450 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma03g09450

Feature Type:	gene_model
Chromosome:	Gm03
Start:	11134215
stop:	11135903
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma03g09450

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G09920	AT	Annotation by Michelle Graham. TAIR10: phosphatidyl inositol monophosphate 5 kinase \| chr3:3040426-3043676 REVERSE LENGTH=815	SoyBase	E_val: 5.00E-12	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0006520	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular amino acid metabolic process	SoyBase	N/A	ISS
GO:0046488	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016307	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol phosphate kinase activity	SoyBase	N/A	ISS
GO:0016308	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 1-phosphatidylinositol-4-phosphate 5-kinase activity	SoyBase	N/A	ISS
PF01504	PFAM	Phosphatidylinositol-4-phosphate 5-Kinase	JGI		ISS
UniRef100_B9S0D1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phosphatidylinositol-4-phosphate 5-kinase, putative n=1 Tax=Ricinus communis RepID=B9S0D1_RICCO	SoyBase	E_val: 6.00E-14	ISS
UniRef100_I1LZB0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZB0_SOYBN	SoyBase	E_val: 1.00E-24	ISS

Expression Patterns of Glyma03g09450

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma03g09450 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g064700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma03g09450

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma03g09450

Limit To All Plant Sequences

>Glyma03g09450.1   sequence type=CDS   gene model=Glyma03g09450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTATTATCTTTCAATTAAAATATGAATGTCTTAATTTCATTTTTGTATGCTCCAAAACACTTCAGTATACGTGTTGTATTTGCATTTGCTATTTTACAGGATATGAAGCGCCAAATTTAAGAAAAAATGGATGTAGGTATGTCTTTGCAGGTGCTATCTTCATGTACGAGAGGTCGCAAACATACAGTAGTTACTGCAGAGACCATCAAGTCCATAATGGTGGAAATTTGTTGGAAGCAATTGAGATTGACAGCAAGTTCTTGGAATTACAACAGATAATGGATTACAGCCTCCTTCTAGGTGTTCATTATCGAGCTCCCCAGCAGTTGCATCCATACAACCAAAGTAGAAATGCAGATGGATTGGCAATTCTTGCAGAGGAAGGTGGGTATCTGATTAGAAAGCTAATGATTTGTGATTTGCCTTTATATGGTAAGCCAAATGAAATAACTAAACCATATAGAATGATGCATAGTGGAAAATGA

Predicted protein sequences of Glyma03g09450

Limit To All Plant Sequences

>Glyma03g09450.1   sequence type=predicted peptide   gene model=Glyma03g09450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLIIFQLKYECLNFIFVCSKTLQYTCCICICYFTGYEAPNLRKNGCRYVFAGAIFMYERSQTYSSYCRDHQVHNGGNLLEAIEIDSKFLELQQIMDYSLLLGVHYRAPQQLHPYNQSRNADGLAILAEEGGYLIRKLMICDLPLYGKPNEITKPYRMMHSGK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain